Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TINAG Peptide - middle region

TINAG Peptide - middle region

Product Specifications

Product Name Alternative

TIN-AG, TIN1, TIN2

UniProt

Q9UJW2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TINAG Rabbit Polyclonal Antibody (orb582613) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055279

Preservative

Lyophilized powder

AA Sequence

VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CellExp™ EGFR/ErbB1, Fc Tag, Human Recombinant
P1337-10 10 µg

Human CellExp™ EGFR/ErbB1, Fc Tag, Human Recombinant

Sign In for Pricing
View Details
Rabbit anti-Human Interleukin-18 (IL-18) polyclonal antibody
PA91385HU-01 50 µg

Rabbit anti-Human Interleukin-18 (IL-18) polyclonal antibody

Sign In for Pricing
View Details
Rabbit anti-Human Interleukin-18 (IL-18) polyclonal antibody
PA91385HU-02 100 µg

Rabbit anti-Human Interleukin-18 (IL-18) polyclonal antibody

Sign In for Pricing
View Details
Rabbit anti-Human Interleukin-18 (IL-18) polyclonal antibody
PA91385HU-03 500 µg

Rabbit anti-Human Interleukin-18 (IL-18) polyclonal antibody

Sign In for Pricing
View Details
Rabbit anti-Human Interleukin-18 (IL-18) polyclonal antibody
PA91385HU-04 1 mg

Rabbit anti-Human Interleukin-18 (IL-18) polyclonal antibody

Sign In for Pricing
View Details
Mouse Cys-C -Cystatin C- CLIA Kit
E-CL-M0248-01 24 Tests

Mouse Cys-C -Cystatin C- CLIA Kit

Sign In for Pricing
View Details