Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TINAGL1 Peptide - middle region

TINAGL1 Peptide - middle region

Product Specifications

Product Name Alternative

ARG1, LCN7, LIECG3, TINAGRP

UniProt

Q9GZM7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TINAGL1 Rabbit Polyclonal Antibody (orb583641) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071447

Preservative

Lyophilized powder

AA Sequence

ENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLIP2 Rabbit Polyclonal Antibody (PE-Cy5)
orb1012940 100 µL

CLIP2 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
1-[2- (4-Chlorophenyl) ethynyl]cyclopentanol
OR1083449-01 250 mg

1-[2- (4-Chlorophenyl) ethynyl]cyclopentanol

Sign In for Pricing
View Details
1-[2- (4-Chlorophenyl) ethynyl]cyclopentanol
OR1083449-02 500 mg

1-[2- (4-Chlorophenyl) ethynyl]cyclopentanol

Sign In for Pricing
View Details
1-[2- (4-Chlorophenyl) ethynyl]cyclopentanol
OR1083449-03 1 g

1-[2- (4-Chlorophenyl) ethynyl]cyclopentanol

Sign In for Pricing
View Details
Porcine Hemoglobin subunit alpha, HBA GENLISA ELISA
KLP0328 96 Well

Porcine Hemoglobin subunit alpha, HBA GENLISA ELISA

Sign In for Pricing
View Details
Sheep UDP Glucose Ceramide Glucosyltransferase ELISA Kit
MBS085291-01 48 Well

Sheep UDP Glucose Ceramide Glucosyltransferase ELISA Kit

Sign In for Pricing
View Details