Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIPRL Peptide - N-terminal region

TIPRL Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC3794, TIP, TIP41, dJ69E11.3, RP1-69E11.1

UniProt

O75663

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TIPRL Rabbit Polyclonal Antibody (orb331166) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_690866

Preservative

Lyophilized powder

AA Sequence

IQHGSGFGIEFNATDALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FETUB Antibody
orb520836-01 50 μL

FETUB Antibody

Sign In for Pricing
View Details
FETUB Antibody
orb520836-02 100 µL

FETUB Antibody

Sign In for Pricing
View Details
Magic™ Membrane Protein Human SCFD1 (Sec1 family domain containing 1) for Antibody Discovery
MP1102X Each

Magic™ Membrane Protein Human SCFD1 (Sec1 family domain containing 1) for Antibody Discovery

Sign In for Pricing
View Details
0.2-10ul Filter Tip, Natural, 1000/Pack
FT216 1PK, 1000UNIT

0.2-10ul Filter Tip, Natural, 1000/Pack

Sign In for Pricing
View Details
Anti-FGFR1 (phospho-Y766) Antibody
A00098Y766 100 µL

Anti-FGFR1 (phospho-Y766) Antibody

Sign In for Pricing
View Details
GATC sgRNA CRISPR Lentivector (Human) (Target 3)
K0843104 1.0 µg DNA

GATC sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details