Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tjp1 Peptide - N-terminal region

Tjp1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZO-1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tjp1 Rabbit Polyclonal Antibody (orb329876) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099736

Preservative

Lyophilized powder

AA Sequence

AIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-MAPK8/MAPK9/MAPK10 (Y185) Antibody
A11181-100UG 100 µg

Phospho-MAPK8/MAPK9/MAPK10 (Y185) Antibody

Sign In for Pricing
View Details
CIT, CT (Citron Rho-interacting Kinase, CRIK, Serine/Threonine-protein Kinase 21, KIAA0949, STK21) (PE) discontinued
C5804-20A-PE 200 µL

CIT, CT (Citron Rho-interacting Kinase, CRIK, Serine/Threonine-protein Kinase 21, KIAA0949, STK21) (PE) discontinued

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) SUMO1 Polyclonal Antibody
MBS7142181 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) SUMO1 Polyclonal Antibody

Sign In for Pricing
View Details
(R) - (+) -Blebbistatin O-Benzoate
T71207-01 25 mg

(R) - (+) -Blebbistatin O-Benzoate

Sign In for Pricing
View Details
(R) - (+) -Blebbistatin O-Benzoate
T71207-02 50 mg

(R) - (+) -Blebbistatin O-Benzoate

Sign In for Pricing
View Details
(R) - (+) -Blebbistatin O-Benzoate
T71207-03 100 mg

(R) - (+) -Blebbistatin O-Benzoate

Sign In for Pricing
View Details