Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tjp1 Peptide - N-terminal region

Tjp1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZO-1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tjp1 Rabbit Polyclonal Antibody (orb329876) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099736

Preservative

Lyophilized powder

AA Sequence

AIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wnt 2 Blocking Peptide
33R-10509 50 ug

Wnt 2 Blocking Peptide

Sign In for Pricing
View Details
casein kinase Iε CRISPR Activation Plasmid (h2)
sc-402163-ACT-2 20 µg

casein kinase Iε CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Rabbit anti-ATP1A1 Antibody
MBS4513729-01 0.05 mL

Rabbit anti-ATP1A1 Antibody

Sign In for Pricing
View Details
Rabbit anti-ATP1A1 Antibody
MBS4513729-02 0.1 mL

Rabbit anti-ATP1A1 Antibody

Sign In for Pricing
View Details
Rabbit anti-ATP1A1 Antibody
MBS4513729-03 5x 0.1 mL

Rabbit anti-ATP1A1 Antibody

Sign In for Pricing
View Details
Human Serum response factor ELISA Kit
MBS9428546-01 96 Tests

Human Serum response factor ELISA Kit

Sign In for Pricing
View Details