Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLR2 Peptide - middle region

TLR2 Peptide - middle region

Product Specifications

Product Name Alternative

CD282, TIL4

UniProt

O60603

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TLR2 Rabbit Polyclonal Antibody (orb584203) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_003255

Preservative

Lyophilized powder

AA Sequence

VSGMCCALFLLILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNIC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC2L1 Antibody Blocking Peptide
orb1503371 500 µg

CDC2L1 Antibody Blocking Peptide

Sign In for Pricing
View Details
COVID-19 Antigen System Device
500210 20 Tests/Box

COVID-19 Antigen System Device

Sign In for Pricing
View Details
DGKQ, CT (Diacylglycerol Kinase theta, DAG Kinase theta, Diglyceride Kinase theta, DGK-theta, DAGK4) (PE) discontinued
D3441-88-PE 200 µL

DGKQ, CT (Diacylglycerol Kinase theta, DAG Kinase theta, Diglyceride Kinase theta, DGK-theta, DAGK4) (PE) discontinued

Sign In for Pricing
View Details
NAMPT 3'UTR Luciferase Stable Cell Line
TU015194 1.0 mL

NAMPT 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
S.Typhi Paired Antibody
orb423805-01 100 µg

S.Typhi Paired Antibody

Sign In for Pricing
View Details
S.Typhi Paired Antibody
orb423805-02 0.5 mg

S.Typhi Paired Antibody

Sign In for Pricing
View Details