Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLR2 Peptide - N-terminal region

TLR2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD282, TIL4

UniProt

O60603

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TLR2 Rabbit Polyclonal Antibody (orb584204) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_003255

Preservative

Lyophilized powder

AA Sequence

EIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFN gamma antibody
MBS535904-01 0.05 mg

IFN gamma antibody

Sign In for Pricing
View Details
IFN gamma antibody
MBS535904-02 5x 0.05 mg

IFN gamma antibody

Sign In for Pricing
View Details
MMP-9 Recombinant Protein Antigen
NBP1-85575PEP 0.1 mL

MMP-9 Recombinant Protein Antigen

Sign In for Pricing
View Details
Catfish IL-8 Recombinant Protein
RP0439CF 5 µg

Catfish IL-8 Recombinant Protein

Sign In for Pricing
View Details
HRAS Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61138R-BF594-TR 20 µL

HRAS Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
MIRacle™ mmu-miR-133a-5p miRNA Agomir/Antagomir
AM3020 2 OD, 4 OD, 50 OD

MIRacle™ mmu-miR-133a-5p miRNA Agomir/Antagomir

Sign In for Pricing
View Details