Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLR2 Peptide - N-terminal region

TLR2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD282, TIL4

UniProt

O60603

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TLR2 Rabbit Polyclonal Antibody (orb584204) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_003255

Preservative

Lyophilized powder

AA Sequence

EIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccdc28a sgRNA CRISPR Lentivector (Rat) (Target 1)
K7336702 1.0 µg DNA

Ccdc28a sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Pig Dual oxidase 2 ELISA Kit
MBS2884429-01 48 Well

Pig Dual oxidase 2 ELISA Kit

Sign In for Pricing
View Details
Pig Dual oxidase 2 ELISA Kit
MBS2884429-02 96 Well

Pig Dual oxidase 2 ELISA Kit

Sign In for Pricing
View Details
Pig Dual oxidase 2 ELISA Kit
MBS2884429-03 5x 96 Well

Pig Dual oxidase 2 ELISA Kit

Sign In for Pricing
View Details
Pig Dual oxidase 2 ELISA Kit
MBS2884429-04 10x 96 Well

Pig Dual oxidase 2 ELISA Kit

Sign In for Pricing
View Details
VPS39 CRISPR Activation Plasmid (h2)
sc-404507-ACT-2 20 µg

VPS39 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details