Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLR8 Peptide - C-terminal region

TLR8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD288, MGC119599, MGC119600

UniProt

Q9NR97

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TLR8 Rabbit Polyclonal Antibody (orb584206) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_619542

Preservative

Lyophilized powder

AA Sequence

LEPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLFWQTLRNVVLTENDSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNL1 Polyclonal Antibody
E-AB-61887-01 60 µL

TXNL1 Polyclonal Antibody

Sign In for Pricing
View Details
TXNL1 Polyclonal Antibody
E-AB-61887-02 120 µL

TXNL1 Polyclonal Antibody

Sign In for Pricing
View Details
TXNL1 Polyclonal Antibody
E-AB-61887-03 200 µL

TXNL1 Polyclonal Antibody

Sign In for Pricing
View Details
MEK6 Recombinant Rabbit Monoclonal Antibody [PSH07-86]
HA722917 100 µL

MEK6 Recombinant Rabbit Monoclonal Antibody [PSH07-86]

Sign In for Pricing
View Details
ZNF737 Human Gene Knockout Kit (CRISPR)
KN428435 1 Kit

ZNF737 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant PTEN Monoclonal Antibody
AN301026L-01 50 µL

Recombinant PTEN Monoclonal Antibody

Sign In for Pricing
View Details