Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM2D2 Peptide - middle region

TM2D2 Peptide - middle region

Product Specifications

Product Name Alternative

BLP1, MGC125813, MGC125814

UniProt

Q9BX73

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TM2D2 Rabbit Polyclonal Antibody (orb584731) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_510882

Preservative

Lyophilized powder

AA Sequence

QELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Thyroglobulin, TG ELISA Kit
MBS702965-01 24 Well (LIMIT 1)

Human Thyroglobulin, TG ELISA Kit

Sign In for Pricing
View Details
Human Thyroglobulin, TG ELISA Kit
MBS702965-02 48 Well

Human Thyroglobulin, TG ELISA Kit

Sign In for Pricing
View Details
Human Thyroglobulin, TG ELISA Kit
MBS702965-03 96 Well

Human Thyroglobulin, TG ELISA Kit

Sign In for Pricing
View Details
Human Thyroglobulin, TG ELISA Kit
MBS702965-04 5x 96 Well

Human Thyroglobulin, TG ELISA Kit

Sign In for Pricing
View Details
Human Thyroglobulin, TG ELISA Kit
MBS702965-05 10x 96 Well

Human Thyroglobulin, TG ELISA Kit

Sign In for Pricing
View Details
Luminespib analog
HY-10976 1 Each

Luminespib analog

Sign In for Pricing
View Details