Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM2D2 Peptide - middle region

TM2D2 Peptide - middle region

Product Specifications

Product Name Alternative

BLP1, MGC125813, MGC125814

UniProt

Q9BX73

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TM2D2 Rabbit Polyclonal Antibody (orb584731) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_510882

Preservative

Lyophilized powder

AA Sequence

QELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-A*01:01&B2M&CT83 (NTDNNLAVY) Monomer [Biotin], His&Avi, Human
Z06813-100 100 µg

HLA-A*01:01&B2M&CT83 (NTDNNLAVY) Monomer [Biotin], His&Avi, Human

Sign In for Pricing
View Details
SMTNL2 Protein Vector (Mouse) (pPB-C-His)
PV232110 500 ng

SMTNL2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Human Histidine Rich Glycoprotein (HRG) ELISA Kit
MBS459911-01 48 Tests

Human Histidine Rich Glycoprotein (HRG) ELISA Kit

Sign In for Pricing
View Details
Human Histidine Rich Glycoprotein (HRG) ELISA Kit
MBS459911-02 96 Tests

Human Histidine Rich Glycoprotein (HRG) ELISA Kit

Sign In for Pricing
View Details
Human Histidine Rich Glycoprotein (HRG) ELISA Kit
MBS459911-03 5x 96 Tests

Human Histidine Rich Glycoprotein (HRG) ELISA Kit

Sign In for Pricing
View Details
Human Histidine Rich Glycoprotein (HRG) ELISA Kit
MBS459911-04 10x 96 Tests

Human Histidine Rich Glycoprotein (HRG) ELISA Kit

Sign In for Pricing
View Details