TM7SF4 Peptide - N-terminal region
TM7SF4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
DCSTAMP, FIND, MGC138223, MGC138225, TM7SF4
UniProt
Q9H295
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TM7SF4 Rabbit Polyclonal Antibody (orb325526) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_110415
Preservative
Lyophilized powder
AA Sequence
AGTGIVILGHVENIFHNFKGLLDGMTCNLRAKSFSIHFPLLKKYIEAIQW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-D479655-25MG 25 mg
1,2-Dimyristoyl-sn-glycero-3-phosphate Sodium Salt
Sign In for Pricing
View Details 
KN418403 1 Kit
KiSS1 receptor (KISS1R) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
BNC880507-500 1x 500 µL
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
