Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM7SF4 Peptide - N-terminal region

TM7SF4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DCSTAMP, FIND, MGC138223, MGC138225, TM7SF4

UniProt

Q9H295

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TM7SF4 Rabbit Polyclonal Antibody (orb325526) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110415

Preservative

Lyophilized powder

AA Sequence

AGTGIVILGHVENIFHNFKGLLDGMTCNLRAKSFSIHFPLLKKYIEAIQW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT2 (C-term) Rabbit Polyclonal Antibody
AP11564PU-N 400 µL

STAT2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AFF4 (N-term) Rabbit Polyclonal Antibody
AP50103PU-N 400 µL

AFF4 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL
BNC880149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Drotaveraldine
TRC-D689670-10MG 10 mg

Drotaveraldine

Sign In for Pricing
View Details
FOXO4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8F1]
TA810532BM 100 µL

FOXO4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8F1]

Sign In for Pricing
View Details
Recombinant Human SIGLEC5 Protein
PKSH030999 100 µg

Recombinant Human SIGLEC5 Protein

Sign In for Pricing
View Details