Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmco3 Peptide - middle region

Tmco3 Peptide - middle region

Product Specifications

Product Name Alternative

B230339H12Rik, C87304

UniProt

Q8BH01

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tmco3 Rabbit Polyclonal Antibody (orb580030) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_758486

Preservative

Lyophilized powder

AA Sequence

MLIDSQNNQYILTKPRDSTIPRADHHFIKDIVTIGMLSLPCGWLCTAIGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS704049 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Rbm15 Mouse Monoclonal Antibody [A10H4]
HA601347 100 µL

Rbm15 Mouse Monoclonal Antibody [A10H4]

Sign In for Pricing
View Details
TTMB (TMEM200B) (NM_001171868) Human Over-expression Lysate
LC432859 20 µg

TTMB (TMEM200B) (NM_001171868) Human Over-expression Lysate

Sign In for Pricing
View Details
Altrenogest
TRC-A575755-500MG 500 mg

Altrenogest

Sign In for Pricing
View Details
Recombinant Human OX40/TNFRSF4 Protein (Fc & Avi Tag)
PKSH033797-01 20 µg

Recombinant Human OX40/TNFRSF4 Protein (Fc & Avi Tag)

Sign In for Pricing
View Details
Recombinant Human OX40/TNFRSF4 Protein (Fc & Avi Tag)
PKSH033797-02 100 µg

Recombinant Human OX40/TNFRSF4 Protein (Fc & Avi Tag)

Sign In for Pricing
View Details