Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmco3 Peptide - middle region

Tmco3 Peptide - middle region

Product Specifications

Product Name Alternative

B230339H12Rik, C87304

UniProt

Q8BH01

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tmco3 Rabbit Polyclonal Antibody (orb580030) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_758486

Preservative

Lyophilized powder

AA Sequence

MLIDSQNNQYILTKPRDSTIPRADHHFIKDIVTIGMLSLPCGWLCTAIGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pomalidomide
TRC-P688200-250MG 250 mg

Pomalidomide

Sign In for Pricing
View Details
TUBAL3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G6]
TA503931BM 100 µL

TUBAL3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G6]

Sign In for Pricing
View Details
p75 NGF Receptor (NGFR) Mouse Monoclonal Antibody [Clone ID: OTI8A7]
CF812986 100 µg

p75 NGF Receptor (NGFR) Mouse Monoclonal Antibody [Clone ID: OTI8A7]

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), 1mg/mL
BNUM1919-50 1x 50 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), 1mg/mL

Sign In for Pricing
View Details
Mouse Bcl2a1b activation kit by CRISPRa
GA200384 1 Kit

Mouse Bcl2a1b activation kit by CRISPRa

Sign In for Pricing
View Details
Thermo Shaker Incubator BSTH-205
BSTH-205 1 Unit

Thermo Shaker Incubator BSTH-205

Sign In for Pricing
View Details