Tmed1 Peptide - N-terminal region
Tmed1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Il1rl1l, MGC108769, Tmed1
UniProt
Q5BK85
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Tmed1 Rabbit Polyclonal Antibody (orb579880) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001013450
Preservative
Lyophilized powder
AA Sequence
EAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741948-100 1x 100 µL
Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042641-500 1x 500 µL
Prolactin (Pituitary Tumor Marker) (PRL/2641), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details