Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem110 Peptide - C-terminal region

Tmem110 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC108529, Tmem110

UniProt

Q3UF25

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tmem110 Rabbit Polyclonal Antibody (orb326050) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_942069

Preservative

Lyophilized powder

AA Sequence

VGQCALYIVIMIFEKSVVFIVLLILQWKKVALLNPIENPDLKLAIVMLIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS507089 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Beta-D-Galactopyranosylamine
TRC-G154475-1G 1 g

Beta-D-Galactopyranosylamine

Sign In for Pricing
View Details
Phospho-VASP (S156) Recombinant Rabbit Monoclonal Antibody [JE45-91]
HA722145 100 µL

Phospho-VASP (S156) Recombinant Rabbit Monoclonal Antibody [JE45-91]

Sign In for Pricing
View Details
Human TMEM183BP activation kit by CRISPRa
GA118861 1 Kit

Human TMEM183BP activation kit by CRISPRa

Sign In for Pricing
View Details
CHST11 Polyclonal Antibody
E-AB-90659-01 60 µL

CHST11 Polyclonal Antibody

Sign In for Pricing
View Details
CHST11 Polyclonal Antibody
E-AB-90659-02 120 µL

CHST11 Polyclonal Antibody

Sign In for Pricing
View Details