Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem110 Peptide - C-terminal region

Tmem110 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC108529, Tmem110

UniProt

Q3UF25

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tmem110 Rabbit Polyclonal Antibody (orb326050) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_942069

Preservative

Lyophilized powder

AA Sequence

VGQCALYIVIMIFEKSVVFIVLLILQWKKVALLNPIENPDLKLAIVMLIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HOXB4 Protein (His Tag)
PKSH033457-01 10 µg

Recombinant Human HOXB4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human HOXB4 Protein (His Tag)
PKSH033457-02 50 µg

Recombinant Human HOXB4 Protein (His Tag)

Sign In for Pricing
View Details
NTRK1 Antibody
F40240-0.08ML 0.08 mL

NTRK1 Antibody

Sign In for Pricing
View Details
2-Ethoxybenzoic Acid
TRC-E890660-25G 25 g

2-Ethoxybenzoic Acid

Sign In for Pricing
View Details
Ethyl Isodehydroacetate
TRC-E921350-50G 50 g

Ethyl Isodehydroacetate

Sign In for Pricing
View Details
Human FAM126A activation kit by CRISPRa
GA113642 1 Kit

Human FAM126A activation kit by CRISPRa

Sign In for Pricing
View Details