Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem132d Peptide - middle region

Tmem132d Peptide - middle region

Product Specifications

Product Name Alternative

C630028F04Rik

UniProt

Q76HP3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tmem132d Rabbit Polyclonal Antibody (orb581045) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766473

Preservative

Lyophilized powder

AA Sequence

QRPKQEAAISCWVQFSDGSVTPLDIYDEKDFSLMATSLDEKVVSILQDPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tlk2 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7137504 1.0 µg DNA

Tlk2 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
GCLC Adenovirus (Human)
21386052 1.0 mL

GCLC Adenovirus (Human)

Sign In for Pricing
View Details
GTS Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
22825061 1.0 µg DNA

GTS Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit Polyclonal EBOV GP1 Antibody [DyLight 680]
NBP3-05820FR 0.1 mL

Rabbit Polyclonal EBOV GP1 Antibody [DyLight 680]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS604943 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
ZNF793 Antibody
GWB-MR885C 50 µg

ZNF793 Antibody

Sign In for Pricing
View Details