Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem132d Peptide - middle region

Tmem132d Peptide - middle region

Product Specifications

Product Name Alternative

C630028F04Rik

UniProt

Q76HP3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tmem132d Rabbit Polyclonal Antibody (orb581045) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766473

Preservative

Lyophilized powder

AA Sequence

QRPKQEAAISCWVQFSDGSVTPLDIYDEKDFSLMATSLDEKVVSILQDPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-inaD (Thr666) Rabbit Polyclonal Antibody (BF405)
orb2498140 100 µL

Phospho-inaD (Thr666) Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
VSTM2A Protein Vector (Mouse) (pPB-N-His)
PV246695 500 ng

VSTM2A Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human Zinc finger protein 234, ZNF234 ELISA Kit
MBS9331163-01 48 Well

Human Zinc finger protein 234, ZNF234 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein 234, ZNF234 ELISA Kit
MBS9331163-02 96 Well

Human Zinc finger protein 234, ZNF234 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein 234, ZNF234 ELISA Kit
MBS9331163-03 5x 96 Well

Human Zinc finger protein 234, ZNF234 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein 234, ZNF234 ELISA Kit
MBS9331163-04 10x 96 Well

Human Zinc finger protein 234, ZNF234 ELISA Kit

Sign In for Pricing
View Details