TMEM139 Peptide - N-terminal region
TMEM139 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ90586
UniProt
Q8IV31
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMEM139 Rabbit Polyclonal Antibody (orb325829) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_699176
Preservative
Lyophilized powder
AA Sequence
ITPVAYFFLTLGGFFLFAYLLVRFLEWGLRSQLQSMQTESPGPSGNARDN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400008-500 1x 500 µL
MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470096-500 1x 500 µL
Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 