TMEM141 Peptide - C-terminal region
TMEM141 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MGC14141, RP11-216L13.7
UniProt
Q96I45
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMEM141 Rabbit Polyclonal Antibody (orb326367) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_116317
Preservative
Lyophilized powder
AA Sequence
PLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041820-100 1x 100 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400226-500 1x 500 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470826-100 1x 100 µL
Ep-CAM / CD326 (EGP40/826), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details