Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANO6 Peptide - middle region

ANO6 Peptide - middle region

Product Specifications

Product Name Alternative

MGC104751, SCTS, BDPLT7, TMEM16F

UniProt

Q4KMQ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANO6 Rabbit Polyclonal Antibody (orb579281) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020527

Preservative

Lyophilized powder

AA Sequence

KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Asn (Trt) -Ser (psi (Me, Me) pro) -OH
orb1909051-01 100 mg

Fmoc-Asn (Trt) -Ser (psi (Me, Me) pro) -OH

Sign In for Pricing
View Details
Fmoc-Asn (Trt) -Ser (psi (Me, Me) pro) -OH
orb1909051-02 500 mg

Fmoc-Asn (Trt) -Ser (psi (Me, Me) pro) -OH

Sign In for Pricing
View Details
NKX6-3 Protein Vector (Human) (pPM-C-His)
PV104525 500 ng

NKX6-3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Phenylalanine--tRNA ligase beta subunit Antibody
orb3165998 100 µg

Phenylalanine--tRNA ligase beta subunit Antibody

Sign In for Pricing
View Details
Ear cress EMB140 Rabbit Polyclonal Antibody (APC)
orb2573446 200 µL

Ear cress EMB140 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
CLPS Rabbit Polyclonal Antibody (BF647)
orb2554830 100 µL

CLPS Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details