Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANO6 Peptide - middle region

ANO6 Peptide - middle region

Product Specifications

Product Name Alternative

MGC104751, SCTS, BDPLT7, TMEM16F

UniProt

Q4KMQ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANO6 Rabbit Polyclonal Antibody (orb579281) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020527

Preservative

Lyophilized powder

AA Sequence

KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Streptoalloteichus tenebrarius L-glutamine:2-deoxy-scyllo-inosose aminotransferase (tbmB)
MBS1449468-01 0.05 mg (E-Coli)

Recombinant Streptoalloteichus tenebrarius L-glutamine:2-deoxy-scyllo-inosose aminotransferase (tbmB)

Sign In for Pricing
View Details
Recombinant Streptoalloteichus tenebrarius L-glutamine:2-deoxy-scyllo-inosose aminotransferase (tbmB)
MBS1449468-02 0.05 mg (Yeast)

Recombinant Streptoalloteichus tenebrarius L-glutamine:2-deoxy-scyllo-inosose aminotransferase (tbmB)

Sign In for Pricing
View Details
Recombinant Streptoalloteichus tenebrarius L-glutamine:2-deoxy-scyllo-inosose aminotransferase (tbmB)
MBS1449468-03 0.05 mg (Baculovirus)

Recombinant Streptoalloteichus tenebrarius L-glutamine:2-deoxy-scyllo-inosose aminotransferase (tbmB)

Sign In for Pricing
View Details
Recombinant Streptoalloteichus tenebrarius L-glutamine:2-deoxy-scyllo-inosose aminotransferase (tbmB)
MBS1449468-04 0.2 mg (E-Coli)

Recombinant Streptoalloteichus tenebrarius L-glutamine:2-deoxy-scyllo-inosose aminotransferase (tbmB)

Sign In for Pricing
View Details
Recombinant Streptoalloteichus tenebrarius L-glutamine:2-deoxy-scyllo-inosose aminotransferase (tbmB)
MBS1449468-05 0.5 mg (E-Coli)

Recombinant Streptoalloteichus tenebrarius L-glutamine:2-deoxy-scyllo-inosose aminotransferase (tbmB)

Sign In for Pricing
View Details
Recombinant Streptoalloteichus tenebrarius L-glutamine:2-deoxy-scyllo-inosose aminotransferase (tbmB)
MBS1449468-06 0.2 mg (Yeast)

Recombinant Streptoalloteichus tenebrarius L-glutamine:2-deoxy-scyllo-inosose aminotransferase (tbmB)

Sign In for Pricing
View Details