Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem184b Peptide - middle region

Tmem184b Peptide - middle region

Product Specifications

Product Name Alternative

RGD1306591

UniProt

Q4QQS1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tmem184b Rabbit Polyclonal Antibody (orb579910) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001166841

Preservative

Lyophilized powder

AA Sequence

STVILQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATREL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sostdc1 AAV siRNA Pooled Vector
45127164 1.0 µg

Sostdc1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
VGLUT2 Polyclonal Antibody, Cy5.5 Conjugated
bs-9686R-Cy5.5 100 µL

VGLUT2 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
HPLC Column, CN,5μm,120Å,7.8x150mm
13011791 1 PC

HPLC Column, CN,5μm,120Å,7.8x150mm

Sign In for Pricing
View Details
THG1L Protein Vector (Rat) (pPM-C-His)
PV310697 500 ng

THG1L Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Lusutrombopag Impurity 62
RM-L368062-01 10 mg

Lusutrombopag Impurity 62

Sign In for Pricing
View Details
Lusutrombopag Impurity 62
RM-L368062-02 100 mg

Lusutrombopag Impurity 62

Sign In for Pricing
View Details