Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM195 Peptide - middle region

TMEM195 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ16237, MGC131748, TMEM195

UniProt

Q6ZNB7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM195 Rabbit Polyclonal Antibody (orb325156) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004320

Preservative

Lyophilized powder

AA Sequence

AGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALFIPPSVYAVHLQF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Aminobenzoyl chloride
OR97196 1 Each

3-Aminobenzoyl chloride

Sign In for Pricing
View Details
Human Zinc finger protein with KRAB and SCAN domains 2, ZKSCAN2 ELISA Kit
MBS9336523-01 48 Well

Human Zinc finger protein with KRAB and SCAN domains 2, ZKSCAN2 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein with KRAB and SCAN domains 2, ZKSCAN2 ELISA Kit
MBS9336523-02 96 Well

Human Zinc finger protein with KRAB and SCAN domains 2, ZKSCAN2 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein with KRAB and SCAN domains 2, ZKSCAN2 ELISA Kit
MBS9336523-03 5x 96 Well

Human Zinc finger protein with KRAB and SCAN domains 2, ZKSCAN2 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein with KRAB and SCAN domains 2, ZKSCAN2 ELISA Kit
MBS9336523-04 10x 96 Well

Human Zinc finger protein with KRAB and SCAN domains 2, ZKSCAN2 ELISA Kit

Sign In for Pricing
View Details
ZNF438 (NM_001143767) Human Tagged ORF Clone Lentiviral Particle
RC227783L4V 200 µL

ZNF438 (NM_001143767) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details