TMEM195 Peptide - middle region
TMEM195 Peptide - middle region
Product Specifications
Product Name Alternative
FLJ16237, MGC131748, TMEM195
UniProt
Q6ZNB7
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMEM195 Rabbit Polyclonal Antibody (orb325156) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001004320
Preservative
Lyophilized powder
AA Sequence
AGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALFIPPSVYAVHLQF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
T9220-02E 50 µg
Tyk2 (Non-receptor Tyrosine-protein Kinase TYK2) discontinued
Sign In for Pricing
View Details 
bs-8027R-PE-Cy5 100 µL
CNIH3 Polyclonal Antibody, PE-Cy5 Conjugated
Sign In for Pricing
View Details 
LV788016 1.0 µg DNA
TRBJ1-5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details NBP3-14027JF635 0.1 mL
Mouse Monoclonal Ornithine Decarboxylase Antibody (rODC1/487) [Janelia Fluor 635]
Sign In for Pricing
View Details 249299-PE 100 µL
NFKBIB (Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B-Cells Inhibitor, beta, IKBB, TRIP9) (PE)
Sign In for Pricing
View Details