Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEMIP2 Peptide - N-terminal region

CEMIP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Tmem2

UniProt

Q5FWI3

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEMIP2 Rabbit Polyclonal Antibody (orb325001) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028931

Preservative

Lyophilized powder

AA Sequence

MYAAGSRGHSPAFLQPQNGNGHRSPGYVPGKVVPLRPAPPPKNHASAKLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit alpha1-Acid glycoprotein (alpha1-AGP) ELISA Kit
EIA07058Rb 1 Kit

Rabbit alpha1-Acid glycoprotein (alpha1-AGP) ELISA Kit

Sign In for Pricing
View Details
CHCHD3 Mouse Monoclonal Antibody [KD Validation]
E51K63568 40 µL

CHCHD3 Mouse Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
DYX1C1, Control Peptide (Dyslexia Susceptibility 1 Candidate Gene 1 Protein, EKN1, FLJ37882, MGC70618, RD)
147871 100 µg

DYX1C1, Control Peptide (Dyslexia Susceptibility 1 Candidate Gene 1 Protein, EKN1, FLJ37882, MGC70618, RD)

Sign In for Pricing
View Details
PRR20B Protein Vector (Human) (pPM-C-His)
PV113457 500 ng

PRR20B Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
STK16 Protein (N-GST, Human)
P528793 100 µg

STK16 Protein (N-GST, Human)

Sign In for Pricing
View Details
Mouse Beclin 1, BECN1 ELISA KIT
E1134Mo-01 48 Well

Mouse Beclin 1, BECN1 ELISA KIT

Sign In for Pricing
View Details