Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPRSS3 Peptide - N-terminal region

TMPRSS3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DFNB10, DFNB8, ECHOS1, TADG12

UniProt

P57727

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMPRSS3 Rabbit Polyclonal Antibody (orb330936) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076927

Preservative

Lyophilized powder

AA Sequence

MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arl6 Mouse siRNA Oligo Duplex (Locus ID 56297)
SR404589 1 Kit

Arl6 Mouse siRNA Oligo Duplex (Locus ID 56297)

Sign In for Pricing
View Details
Recombinant Candida Albicans CWC25 Protein (aa 1-221)
VAng-Lsx05464-50gEcoli 50 µg (E. coli)

Recombinant Candida Albicans CWC25 Protein (aa 1-221)

Sign In for Pricing
View Details
PI3KC2G, NT (Phosphatidylinositol-4-phosphate 3-kinase C2 Domain-containing Subunit gamma, Phosphoinositide 3-kinase-C2-gamma, PI3K-C2gamma, PI3K-C2-gamma, PIK3C2G, PtdIns-3-kinase C2 Subunit gamma, MGC163149) (MaxLight 650)
MBS6493495-01 0.1 mL

PI3KC2G, NT (Phosphatidylinositol-4-phosphate 3-kinase C2 Domain-containing Subunit gamma, Phosphoinositide 3-kinase-C2-gamma, PI3K-C2gamma, PI3K-C2-gamma, PIK3C2G, PtdIns-3-kinase C2 Subunit gamma, MGC163149) (MaxLight 650)

Sign In for Pricing
View Details
PI3KC2G, NT (Phosphatidylinositol-4-phosphate 3-kinase C2 Domain-containing Subunit gamma, Phosphoinositide 3-kinase-C2-gamma, PI3K-C2gamma, PI3K-C2-gamma, PIK3C2G, PtdIns-3-kinase C2 Subunit gamma, MGC163149) (MaxLight 650)
MBS6493495-02 5x 0.1 mL

PI3KC2G, NT (Phosphatidylinositol-4-phosphate 3-kinase C2 Domain-containing Subunit gamma, Phosphoinositide 3-kinase-C2-gamma, PI3K-C2gamma, PI3K-C2-gamma, PIK3C2G, PtdIns-3-kinase C2 Subunit gamma, MGC163149) (MaxLight 650)

Sign In for Pricing
View Details
Prrxl1 Antibody - middle region (ARP36802_P050)
ARP36802_P050 100 µL

Prrxl1 Antibody - middle region (ARP36802_P050)

Sign In for Pricing
View Details
Dengue NS 1 antigen Test
GCDEN (NS) -402 25 Tests/Box

Dengue NS 1 antigen Test

Sign In for Pricing
View Details