Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPRSS3 Peptide - N-terminal region

TMPRSS3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DFNB10, DFNB8, ECHOS1, TADG12

UniProt

P57727

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMPRSS3 Rabbit Polyclonal Antibody (orb330936) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076927

Preservative

Lyophilized powder

AA Sequence

MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Acanthamoeba polyphaga mimivirus Putative F-box and FNIP repeat-containing protein R286 (MIMI_R286)
MBS1321863-01 0.02 mg (E-Coli)

Recombinant Acanthamoeba polyphaga mimivirus Putative F-box and FNIP repeat-containing protein R286 (MIMI_R286)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Putative F-box and FNIP repeat-containing protein R286 (MIMI_R286)
MBS1321863-02 0.02 mg (Yeast)

Recombinant Acanthamoeba polyphaga mimivirus Putative F-box and FNIP repeat-containing protein R286 (MIMI_R286)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Putative F-box and FNIP repeat-containing protein R286 (MIMI_R286)
MBS1321863-03 0.1 mg (E-Coli)

Recombinant Acanthamoeba polyphaga mimivirus Putative F-box and FNIP repeat-containing protein R286 (MIMI_R286)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Putative F-box and FNIP repeat-containing protein R286 (MIMI_R286)
MBS1321863-04 0.1 mg (Yeast)

Recombinant Acanthamoeba polyphaga mimivirus Putative F-box and FNIP repeat-containing protein R286 (MIMI_R286)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Putative F-box and FNIP repeat-containing protein R286 (MIMI_R286)
MBS1321863-05 0.02 mg (Baculovirus)

Recombinant Acanthamoeba polyphaga mimivirus Putative F-box and FNIP repeat-containing protein R286 (MIMI_R286)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Putative F-box and FNIP repeat-containing protein R286 (MIMI_R286)
MBS1321863-06 0.02 mg (Mammalian-Cell)

Recombinant Acanthamoeba polyphaga mimivirus Putative F-box and FNIP repeat-containing protein R286 (MIMI_R286)

Sign In for Pricing
View Details