Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPRSS3 Peptide - N-terminal region

TMPRSS3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DFNB10, DFNB8, ECHOS1, TADG12

UniProt

Q8WY52

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMPRSS3 Rabbit Polyclonal Antibody (orb330937) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115781

Preservative

Lyophilized powder

AA Sequence

MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PDSS2 Protein, N-His
YHN28101 100 μg

Recombinant Human PDSS2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Oncorhynchus keta NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)
MBS7022050-01 0.02 mg

Recombinant Oncorhynchus keta NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Sign In for Pricing
View Details
Recombinant Oncorhynchus keta NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)
MBS7022050-02 0.1 mg

Recombinant Oncorhynchus keta NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Sign In for Pricing
View Details
Recombinant Oncorhynchus keta NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)
MBS7022050-03 5x 0.1 mg

Recombinant Oncorhynchus keta NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Sign In for Pricing
View Details
Armc7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6554108 1.0 µg DNA

Armc7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
4- (3-Fluoro-4-methylphenyl) benzonitrile
428856-01 100 mg

4- (3-Fluoro-4-methylphenyl) benzonitrile

Sign In for Pricing
View Details