Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMX1 Peptide - C-terminal region

TMX1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp564E1962, PDIA11, TMX, TXNDC, TXNDC1

UniProt

Q9H3N1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMX1 Rabbit Polyclonal Antibody (orb585474) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110382

Preservative

Lyophilized powder

AA Sequence

SKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat sCD86 (Soluble Cluster of Differentiation 86) ELISA Kit
E-EL-R0891-01 24 Tests

Rat sCD86 (Soluble Cluster of Differentiation 86) ELISA Kit

Sign In for Pricing
View Details
Rat sCD86 (Soluble Cluster of Differentiation 86) ELISA Kit
E-EL-R0891-02 48 Tests

Rat sCD86 (Soluble Cluster of Differentiation 86) ELISA Kit

Sign In for Pricing
View Details
Rat sCD86 (Soluble Cluster of Differentiation 86) ELISA Kit
E-EL-R0891-03 96 Tests

Rat sCD86 (Soluble Cluster of Differentiation 86) ELISA Kit

Sign In for Pricing
View Details
GFAP (GA-5), CF647 conjugate, 0.1mg/mL
BNC470167-500 1x 500 µL

GFAP (GA-5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/836), CF594 conjugate, 0.1mg/mL
BNC940836-500 1x 500 µL

Cytokeratin 18 (KRT18/836), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BMPR2 (NM_001204) Human Recombinant Protein
TP308673M 100 µg

BMPR2 (NM_001204) Human Recombinant Protein

Sign In for Pricing
View Details