Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tnfrsf12a Peptide - N-terminal region

Tnfrsf12a Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI255180, C87282, Fn14, HPIP, TWEAK-R, TweakR

UniProt

Q9CR75

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tnfrsf12a Rabbit Polyclonal Antibody (orb581350) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038777

Preservative

Lyophilized powder

AA Sequence

MASAWPRSLPQILVLGFGLVLMRAAAGEQAPGTSPCSSGSSWSADLDKCM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRP5 (ABCC5) Mouse Monoclonal Antibody [Clone ID: OTI6C6]
CF808370 100 µg

MRP5 (ABCC5) Mouse Monoclonal Antibody [Clone ID: OTI6C6]

Sign In for Pricing
View Details
Frozen Tissue Sections, Duodenum
CS503850 5x 5 µm

Frozen Tissue Sections, Duodenum

Sign In for Pricing
View Details
Arp2 (ACTR2) (NM_001005386) Human Over-expression Lysate
LY423711 100 µg

Arp2 (ACTR2) (NM_001005386) Human Over-expression Lysate

Sign In for Pricing
View Details
Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Mouse IgA
HAF-446-1 1 mL

Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Mouse IgA

Sign In for Pricing
View Details
N-(4-Bromobutyl)phthalimide
TRC-B682060-25G 25 g

N-(4-Bromobutyl)phthalimide

Sign In for Pricing
View Details
Pure Artocarpus integrifolia Lectin (Jackfruit) -JacalinAIA-
L-6301-25 25 mg

Pure Artocarpus integrifolia Lectin (Jackfruit) -JacalinAIA-

Sign In for Pricing
View Details