Tnfrsf12a Peptide - N-terminal region
Tnfrsf12a Peptide - N-terminal region
Product Specifications
Product Name Alternative
AI255180, C87282, Fn14, HPIP, TWEAK-R, TweakR
UniProt
Q9CR75
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Tnfrsf12a Rabbit Polyclonal Antibody (orb581350) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_038777
Preservative
Lyophilized powder
AA Sequence
MASAWPRSLPQILVLGFGLVLMRAAAGEQAPGTSPCSSGSSWSADLDKCM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP50359PU-N 400 µL
bcl 6 (BCL6) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
![Cytokeratin 17 Recombinant Rabbit Monoclonal Antibody [SR45-06]](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea821bf/imageurl/et1602-16.webp)
ET1602-16 100 µL
Cytokeratin 17 Recombinant Rabbit Monoclonal Antibody [SR45-06]
Sign In for Pricing
View Details 
![MTOR Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G4]](https://cdn.genprice.uk/products/937/68dd1b7c061270361ea1cccd/imageurl/ta805901am.webp)
TA805901AM 100 µL
MTOR Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G4]
Sign In for Pricing
View Details 