Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF9 Peptide - C-terminal region

TNFRSF9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4-1BB, CD137, CDw137, ILA, MGC2172

UniProt

Q07011

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001552

Preservative

Lyophilized powder

AA Sequence

LTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS9 Antibody
8C14045-AAT 50 µg

MRPS9 Antibody

Sign In for Pricing
View Details
CLCC1 Human qPCR Primer Pair (NM_015127)
HP225620 200 Reactions

CLCC1 Human qPCR Primer Pair (NM_015127)

Sign In for Pricing
View Details
HDAC11 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7A7]
TA804436BM 100 µL

HDAC11 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7A7]

Sign In for Pricing
View Details
SIRT2 Human Gene Knockout Kit (CRISPR)
KN200191LP 1 Kit

SIRT2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CFTR Recombinant Rabbit monoclonal Antibody
HA723168 100 µL

CFTR Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Breast cancer suppressor candidate 1 (VWA5A) (NM_014622) Human Recombinant Protein
TP312185 20 µg

Breast cancer suppressor candidate 1 (VWA5A) (NM_014622) Human Recombinant Protein

Sign In for Pricing
View Details