Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF9 Peptide - C-terminal region

TNFRSF9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4-1BB, CD137, CDw137, ILA, MGC2172

UniProt

Q07011

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001552

Preservative

Lyophilized powder

AA Sequence

LTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SURF6 Human Gene Knockout Kit (CRISPR)
KN400741 1 Kit

SURF6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse IL-27A p28 Recombinant Rabbit monoclonal Antibody
HA723625 100 µL

Mouse IL-27A p28 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
MMP3 Mouse Monoclonal Antibody [Clone ID: 1B4]
AM05378PU-N 200 µg

MMP3 Mouse Monoclonal Antibody [Clone ID: 1B4]

Sign In for Pricing
View Details
Zc3h7a Mouse Gene Knockout Kit (CRISPR)
KN519647 1 Kit

Zc3h7a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/826), 0.2mg/mL
BNUB0826-100 1x 100 µL

Ep-CAM / CD326 (EGP40/826), 0.2mg/mL

Sign In for Pricing
View Details
HP1 alpha (CBX5) Rabbit Monoclonal Antibody [Clone ID: RAB-C133]
TA386453 200 µg

HP1 alpha (CBX5) Rabbit Monoclonal Antibody [Clone ID: RAB-C133]

Sign In for Pricing
View Details