Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFSF13 Peptide - middle region

TNFSF13 Peptide - middle region

Product Specifications

Product Name Alternative

APRIL, CD256, TALL2, TRDL-1, UNQ383/PRO715, ligand, ZTNF2, TALL-2

UniProt

O75888

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNFSF13 Rabbit Polyclonal Antibody (orb584859) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003799

Preservative

Lyophilized powder

AA Sequence

EQSSDALEAWENGERSRKRRAVLTQKQKKQHSVLHLVPINATSKDDSDVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPHS2 Recombinant Rabbit Monoclonal Antibody [JB51-33]
ET7107-34 100 µL

NPHS2 Recombinant Rabbit Monoclonal Antibody [JB51-33]

Sign In for Pricing
View Details
RNF146 Rabbit Polyclonal Antibody
TA370148 100 µL

RNF146 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Purified Anti-Human CD79B Antibody[CB3-1]
AN004810P-01 25 µg

Purified Anti-Human CD79B Antibody[CB3-1]

Sign In for Pricing
View Details
Purified Anti-Human CD79B Antibody[CB3-1]
AN004810P-02 100 µg

Purified Anti-Human CD79B Antibody[CB3-1]

Sign In for Pricing
View Details
2’,3’,5’-Tri-O-benzoyl-2-thiouridine
TRC-T771500-250MG 250 mg

2’,3’,5’-Tri-O-benzoyl-2-thiouridine

Sign In for Pricing
View Details
WDR47 Rabbit Polyclonal Antibody
TA370426 100 µL

WDR47 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details