Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFSF13 Peptide - middle region

TNFSF13 Peptide - middle region

Product Specifications

Product Name Alternative

APRIL, CD256, TALL2, TRDL-1, UNQ383/PRO715, ligand, ZTNF2, TALL-2

UniProt

O75888

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNFSF13 Rabbit Polyclonal Antibody (orb584859) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003799

Preservative

Lyophilized powder

AA Sequence

EQSSDALEAWENGERSRKRRAVLTQKQKKQHSVLHLVPINATSKDDSDVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RTL8B (NM_001078173) Human Over-expression Lysate
LY421496 100 µg

RTL8B (NM_001078173) Human Over-expression Lysate

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF488A conjugate, 0.1mg/mL
BNC882123-500 1x 500 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VRK2 (NM_001288836) Human Tagged ORF Clone
RG237915 10 µg

VRK2 (NM_001288836) Human Tagged ORF Clone

Sign In for Pricing
View Details
(S)-(+)-Modafinic Acid
TRC-M482475-25MG 25 mg

(S)-(+)-Modafinic Acid

Sign In for Pricing
View Details
FES (NM_002005) Human Over-expression Lysate
LC419591 20 µg

FES (NM_002005) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse Ly6A/E (Sca-1) Antibody[D7]
E-AB-F1191M-01 50 Tests

Elab Fluor® 647 Anti-Mouse Ly6A/E (Sca-1) Antibody[D7]

Sign In for Pricing
View Details