Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFSF4 Peptide - middle region

TNFSF4 Peptide - middle region

Product Specifications

Product Name Alternative

CD134L, CD252, GP34, OX-40L, OX4OL, TXGP1

UniProt

P23510

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNFSF4 Rabbit Polyclonal Antibody (orb584217) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003317

Preservative

Lyophilized powder

AA Sequence

QEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcam Mouse Gene Knockout Kit (CRISPR)
KN502076 1 Kit

Bcam Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HisA Antibody
orb817129 2 mg

HisA Antibody

Sign In for Pricing
View Details
Human ZSWIM1 siRNA
abx941236-01 15 nmol

Human ZSWIM1 siRNA

Sign In for Pricing
View Details
Human ZSWIM1 siRNA
abx941236-02 30 nmol

Human ZSWIM1 siRNA

Sign In for Pricing
View Details
Sheep Retinoic Acid Early Transcript Gamma (RAET1C) ELISA Kit
MBS9396593-01 48 Well

Sheep Retinoic Acid Early Transcript Gamma (RAET1C) ELISA Kit

Sign In for Pricing
View Details
Sheep Retinoic Acid Early Transcript Gamma (RAET1C) ELISA Kit
MBS9396593-02 96 Well

Sheep Retinoic Acid Early Transcript Gamma (RAET1C) ELISA Kit

Sign In for Pricing
View Details