Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFSF4 Peptide - middle region

TNFSF4 Peptide - middle region

Product Specifications

Product Name Alternative

CD134L, CD252, GP34, OX-40L, OX4OL, TXGP1

UniProt

P23510

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNFSF4 Rabbit Polyclonal Antibody (orb584217) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003317

Preservative

Lyophilized powder

AA Sequence

QEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Phospho Tau (T181) ELISA Kit
EKF58620 96 Tests

Human Phospho Tau (T181) ELISA Kit

Sign In for Pricing
View Details
RASD2 antibody
70R-32069 0.1 mg

RASD2 antibody

Sign In for Pricing
View Details
Rat Contagious Pleuropneumonia (CPP) ELISA Kit
MBS9399885-01 48 Well

Rat Contagious Pleuropneumonia (CPP) ELISA Kit

Sign In for Pricing
View Details
Rat Contagious Pleuropneumonia (CPP) ELISA Kit
MBS9399885-02 96 Well

Rat Contagious Pleuropneumonia (CPP) ELISA Kit

Sign In for Pricing
View Details
Rat Contagious Pleuropneumonia (CPP) ELISA Kit
MBS9399885-03 5x 96 Well

Rat Contagious Pleuropneumonia (CPP) ELISA Kit

Sign In for Pricing
View Details
Rat Contagious Pleuropneumonia (CPP) ELISA Kit
MBS9399885-04 10x 96 Well

Rat Contagious Pleuropneumonia (CPP) ELISA Kit

Sign In for Pricing
View Details