Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNNI3K Peptide - N-terminal region

TNNI3K Peptide - N-terminal region

Product Specifications

Product Name Alternative

CARK, MGC142099, MGC33828

UniProt

Q59H18

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNNI3K Rabbit Polyclonal Antibody (orb580261) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001106279

Preservative

Lyophilized powder

AA Sequence

LLKFGADVNVSGEVGDRPLHLASAKGFLNIAKLLMEEGSKADVNAQDNED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
BNC040178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF405S conjugate, 0.1mg/mL
BNC040449-100 1x 100 µL

CD104 (UM-A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-100 1x 100 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cdc20 (AR12), CF405S conjugate, 0.1mg/mL
BNC040672-500 1x 500 µL

Cdc20 (AR12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DA7), CF647 conjugate, 0.1mg/mL
BNC470198-500 1x 500 µL

Cytokeratin 18 (DA7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-1 (SM1/495), CF594 conjugate, 0.1mg/mL
BNC940495-500 1x 500 µL

SUMO-1 (SM1/495), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details