Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOB1 Peptide - middle region

TOB1 Peptide - middle region

Product Specifications

Product Name Alternative

APRO6, MGC104792, MGC34446, PIG49, TOB, TROB, TROB1

UniProt

P50616

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOB1 Rabbit Polyclonal Antibody (orb581573) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005740

Preservative

Lyophilized powder

AA Sequence

DLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LSM1 3'UTR Lenti-reporter-Luc Vector
27738081 1.0 µg

LSM1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. mediasiatica Phosphatidylserine decarboxylase proenzyme (psd)
MBS1007911-01 0.02 mg (E-Coli)

Recombinant Francisella tularensis subsp. mediasiatica Phosphatidylserine decarboxylase proenzyme (psd)

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. mediasiatica Phosphatidylserine decarboxylase proenzyme (psd)
MBS1007911-02 0.1 mg (E-Coli)

Recombinant Francisella tularensis subsp. mediasiatica Phosphatidylserine decarboxylase proenzyme (psd)

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. mediasiatica Phosphatidylserine decarboxylase proenzyme (psd)
MBS1007911-03 0.02 mg (Yeast)

Recombinant Francisella tularensis subsp. mediasiatica Phosphatidylserine decarboxylase proenzyme (psd)

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. mediasiatica Phosphatidylserine decarboxylase proenzyme (psd)
MBS1007911-04 0.1 mg (Yeast)

Recombinant Francisella tularensis subsp. mediasiatica Phosphatidylserine decarboxylase proenzyme (psd)

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. mediasiatica Phosphatidylserine decarboxylase proenzyme (psd)
MBS1007911-05 0.02 mg (Baculovirus)

Recombinant Francisella tularensis subsp. mediasiatica Phosphatidylserine decarboxylase proenzyme (psd)

Sign In for Pricing
View Details