Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOB1 Peptide - middle region

TOB1 Peptide - middle region

Product Specifications

Product Name Alternative

APRO6, MGC104792, MGC34446, PIG49, TOB, TROB, TROB1

UniProt

P50616

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOB1 Rabbit Polyclonal Antibody (orb581573) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005740

Preservative

Lyophilized powder

AA Sequence

DLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)
MBS2116394-01 0.1 mL

HRP-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)
MBS2116394-02 0.2 mL

HRP-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)
MBS2116394-03 0.5 mL

HRP-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)
MBS2116394-04 1 mL

HRP-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)
MBS2116394-05 5 mL

HRP-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)
MBS2116394-06 5x 5 mL

HRP-Linked Polyclonal Antibody to Chymase 1, Mast Cell (CMA1)

Sign In for Pricing
View Details