Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Toe1 Peptide - middle region

Toe1 Peptide - middle region

Product Specifications

Product Name Alternative

4930584N22Rik, 4933424D16Rik, AI413517

UniProt

Q9D2E2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Toe1 Rabbit Polyclonal Antibody (orb576289) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080930

Preservative

Lyophilized powder

AA Sequence

QSQPGTQTLAEAEDGPPTKQVCEDSLETEKMEQKVAEGEAGDQPGSREGH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR52 ORF Vector (Human) (pORF)
ORF035884 1.0 µg DNA

WDR52 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Keratin 18 (Keratin Type I Cytoskeletal 18, Keratin-18, K18, KRT18, Cell Proliferation-inducing Gene 46 Protein, Cytokeratin-18, CK-18, CYK18, PIG46) (MaxLight 405) discontinued
138064-ML405 100 µL

Keratin 18 (Keratin Type I Cytoskeletal 18, Keratin-18, K18, KRT18, Cell Proliferation-inducing Gene 46 Protein, Cytokeratin-18, CK-18, CYK18, PIG46) (MaxLight 405) discontinued

Sign In for Pricing
View Details
AdmiRa-rno-let-7c-1 Virus
mr0004 250 µL

AdmiRa-rno-let-7c-1 Virus

Sign In for Pricing
View Details
ZNF665 3'UTR GFP Stable Cell Line
TU079347 1.0 mL

ZNF665 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PLV3-U6-GPRC5B-sgRNA3-Cas9-EGFP-Puro Plasmid
PVT77098 2 µg

PLV3-U6-GPRC5B-sgRNA3-Cas9-EGFP-Puro Plasmid

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Protein Zero, Myelin (MPZ)
MBS2142876-01 0.1 mL

FITC-Linked Monoclonal Antibody to Protein Zero, Myelin (MPZ)

Sign In for Pricing
View Details