Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Toe1 Peptide - middle region

Toe1 Peptide - middle region

Product Specifications

Product Name Alternative

4930584N22Rik, 4933424D16Rik, AI413517

UniProt

Q9D2E2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Toe1 Rabbit Polyclonal Antibody (orb576289) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080930

Preservative

Lyophilized powder

AA Sequence

QSQPGTQTLAEAEDGPPTKQVCEDSLETEKMEQKVAEGEAGDQPGSREGH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Liver Carboxylesterase 1/CES1 Mouse Monoclonal Antibody (Carrier-free)
orb3085100 100 µg

Liver Carboxylesterase 1/CES1 Mouse Monoclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
PEX11A Antibody (Biotin)
orb515737-01 50 µg

PEX11A Antibody (Biotin)

Sign In for Pricing
View Details
PEX11A Antibody (Biotin)
orb515737-02 100 µg

PEX11A Antibody (Biotin)

Sign In for Pricing
View Details
CLEC18A 3'UTR GFP Stable Cell Line
TU054571 1.0 mL

CLEC18A 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Formyl Polystyrene
H50056007.5G 5 g

Formyl Polystyrene

Sign In for Pricing
View Details
SENP2 Antibody
orb1319461 100 µL

SENP2 Antibody

Sign In for Pricing
View Details