Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOM1 Peptide - middle region

TOM1 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ33404

UniProt

O60784

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOM1 Rabbit Polyclonal Antibody (orb581560) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005479

Preservative

Lyophilized powder

AA Sequence

SGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRA2 (FOSL2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7E4]
TA809661BM 100 µL

FRA2 (FOSL2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7E4]

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS705456 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/2927), CF405S conjugate, 0.1mg/mL
BNC042927-100 1x 100 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/2927), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Liver
CB511859 1 Block

Frozen Tissue Blocks, Liver

Sign In for Pricing
View Details
4-Carboxy-Mephedrone Hydrochloride
TRC-C179925-25MG 25 mg

4-Carboxy-Mephedrone Hydrochloride

Sign In for Pricing
View Details
Tissue Total RNA, Pancreas, ectopic
CR561949 5 µg

Tissue Total RNA, Pancreas, ectopic

Sign In for Pricing
View Details