Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOMM70 Peptide - N-terminal region

TOMM70 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Tom70, TOMM70A

UniProt

O94826

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOMM70 Rabbit Polyclonal Antibody (orb585241) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055635

Preservative

Lyophilized powder

AA Sequence

YLWSRQQRRREARGRGDASGLKRNSERKTPEGRASPAPGSGHPEGPGAHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GARNL3 Polyclonal Antibody
E-AB-17988-01 20 µL

GARNL3 Polyclonal Antibody

Sign In for Pricing
View Details
GARNL3 Polyclonal Antibody
E-AB-17988-02 60 µL

GARNL3 Polyclonal Antibody

Sign In for Pricing
View Details
GARNL3 Polyclonal Antibody
E-AB-17988-03 120 µL

GARNL3 Polyclonal Antibody

Sign In for Pricing
View Details
GARNL3 Polyclonal Antibody
E-AB-17988-04 200 µL

GARNL3 Polyclonal Antibody

Sign In for Pricing
View Details
HA tag, AlpHcAbs® Mouse IgG2a
HA710216 100 µg

HA tag, AlpHcAbs® Mouse IgG2a

Sign In for Pricing
View Details
Recombinant Human Afamin/AFM (C-6His)
PKSH033942-01 10 µg

Recombinant Human Afamin/AFM (C-6His)

Sign In for Pricing
View Details