Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TP53INP2 Peptide - C-terminal region

TP53INP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf110, DKFZp434B2411, DKFZp434O0827, DOR, FLJ21759, FLJ23500, PINH, dJ1181N3.1

UniProt

Q8IXH6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TP53INP2 Rabbit Polyclonal Antibody (orb584181) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067025

Preservative

Lyophilized powder

AA Sequence

RLQRARQRAERHALSAKAVQRQNRARESRPRRSKNQSSFIYQPCQRQFNY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DUSP10 Antibody [DyLight 350]
NBP1-30062UV 0.1 mL

Rabbit Polyclonal DUSP10 Antibody [DyLight 350]

Sign In for Pricing
View Details
Anti-Inhibin Beta E (INHBE) Polyclonal antibody
FY-AB34149-01 1 mL

Anti-Inhibin Beta E (INHBE) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Inhibin Beta E (INHBE) Polyclonal antibody
FY-AB34149-02 100 µL

Anti-Inhibin Beta E (INHBE) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Inhibin Beta E (INHBE) Polyclonal antibody
FY-AB34149-03 200 µL

Anti-Inhibin Beta E (INHBE) Polyclonal antibody

Sign In for Pricing
View Details
2-Amino-5- (4- (tert-butyl) phenyl) thiazole-4-carboxylic acid
OR1036445-01 10 mg

2-Amino-5- (4- (tert-butyl) phenyl) thiazole-4-carboxylic acid

Sign In for Pricing
View Details
2-Amino-5- (4- (tert-butyl) phenyl) thiazole-4-carboxylic acid
OR1036445-02 50 mg

2-Amino-5- (4- (tert-butyl) phenyl) thiazole-4-carboxylic acid

Sign In for Pricing
View Details