TPD52L2 Peptide - C-terminal region
TPD52L2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
D54, DKFZp686A1765, hD54
UniProt
O43399
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TPD52L2 Rabbit Polyclonal Antibody (orb331172) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003279
Preservative
Lyophilized powder
AA Sequence
EKVTQSDLYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
P015-A813-500 1x 500 µL
CD9 Recombinant Monoclonal Mouse Antibody (2310.9), APC-AstralTM813 Conjugate - Biotium Choice
Sign In for Pricing
View Details ![LOC102641613 Mouse Monoclonal Antibody [Clone ID: 34-5-8S]](https://cdn.genprice.uk/products/937/68dd18bc061270361e909305/imageurl/cl053b.webp)
CL053B 100 µg
LOC102641613 Mouse Monoclonal Antibody [Clone ID: 34-5-8S]
Sign In for Pricing
View Details 
HAF-002-1 1 mL
Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Human IgA
Sign In for Pricing
View Details 
