Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPD52L2 Peptide - C-terminal region

TPD52L2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

D54, DKFZp686A1765, hD54

UniProt

O43399

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TPD52L2 Rabbit Polyclonal Antibody (orb331172) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003279

Preservative

Lyophilized powder

AA Sequence

EKVTQSDLYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parvalbumin Antibody
OC-058-01 50 μL

Parvalbumin Antibody

Sign In for Pricing
View Details
Parvalbumin Antibody
OC-058-02 100 µL

Parvalbumin Antibody

Sign In for Pricing
View Details
Parvalbumin Antibody
OC-058-03 1 mL

Parvalbumin Antibody

Sign In for Pricing
View Details
ELF4 (NM_001127197) Human Over-expression Lysate
LC426701 20 µg

ELF4 (NM_001127197) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Tryptophanyl tRNA synthetase (WARS) activation kit by CRISPRa
GA105135 1 Kit

Human Tryptophanyl tRNA synthetase (WARS) activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Bone
CS648997 5x 5 µm

Frozen Tissue Sections, Bone

Sign In for Pricing
View Details